PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G148300.1.p
Common NameSETIT_015542mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 312aa    MW: 34730.9 Da    PI: 5.5575
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G148300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-14141186247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         g+WT eE+ +++++ +++G g+Wk I r + ++Rt+ q+ s+ qky
  Seita.6G148300.1.p 141 GSWTIEEHRQFLCGLHEYGRGNWKNICRDFVTTRTPAQVSSHAQKY 186
                         79*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-9134187IPR009057Homeodomain-like
PROSITE profilePS5129415.56135191IPR017930Myb domain
SMARTSM007176.6E-10139189IPR001005SANT/Myb domain
SuperFamilySSF466892.01E-14139191IPR009057Homeodomain-like
PfamPF002495.9E-12141186IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.1E-13142189IPR006447Myb domain, plants
CDDcd001672.65E-9142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDPKFNGEWS ASDIRMVKSL IASHDANNNY ANDTNKTHNA IVNELQAWFP QKEKSQVIEL  60
YVDLLVEMML QAQSGNHSVV AISNLVNDNS GIPMEDPPMK NMDMLLASYL KDKTPEAMGM  120
VEEAPQRQVI VPRQKRQHNE GSWTIEEHRQ FLCGLHEYGR GNWKNICRDF VTTRTPAQVS  180
SHAQKYFIKM KCTSEKKRYS INDVGLYNAE QWAHNNSFSQ DPPAFGDAHN PNCYGSSNQI  240
VPMNNVAPVW SPFLYSAGQA SSSQVSTLAG QQLGASSSPA LALEGVGSQM ALTGNQQGDF  300
LPEQWMDIDN M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004959144.11e-148PREDICTED: protein REVEILLE 4-like
TrEMBLK3YMR00.0K3YMR0_SETIT; Uncharacterized protein
STRINGSi015542m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-23MYB family protein